Über das Unternehmen
- Firmenname (rechtlich): QYAOBIO(ChinaPeptides co., Ltd.)
- Internationaler Name: QYAOBIO / ChinaPeptides Co., Ltd., China
- Marke / Handelsname: QYAOBIO
- Registrierungsland: China
- Adresse: ShanghaiShanghaiBuilding 8, Lane 5600, Chuansha Road, Pudong New Area, Shanghai • Shanghai
Beschreibung:
Established in 2008 and based in Pudong, Shanghai, QYAOBIO (ChinaPeptides Co., Ltd.) is a manufacturer and service provider specializing in peptide synthesis, protein and antibody preparation, and related intermediates and fine chemicals, with a product range spanning proteins, peptides, amino acids and derivatives, hormones and other antibiotics. Its facilities maintain a 99.99% pure nitrogen production environment and use liquid nitrogen pre-freezing technology to preserve peptide stability, verifying every peptide sample through both HPLC and mass spectrometry and applying a double Kaiser test at each solid-phase synthesis step, achieving synthesis success rates above 99% for peptides and proteins/antibodies alike; delivery can be as fast as 3 days for peptide synthesis, 1 week for protein preparation, and 4 weeks for antibody customization, with optional solubility testing, endotoxin reports and salt-conversion services. The company holds multiple patented technologies covering peptide synthesis, purification and freeze-drying, keeps tens of thousands of peptides in regular stock, and has served more than 50,000 customers across over 50 countries including major pharmaceutical companies such as Roche and leading research universities, offering OEM, ODM and own-brand production with around 20% of sales exported and standard competitive advantages in brand strength, international certification, delivery speed, production capacity and a rich product line.
Geschäftsaktivitäten
Laborchemikalien, Lösungsmittel & Referenzstandards
Lieferant
Biopharmazeutische Dienstleistungen
Dienstleister
Pharmazeutische Chemikalien
Anbieter für Auftragssynthese
Biopharmazeutische Produkte
DienstleisterHersteller
Pharmazeutische Wirkstoffe (API)
DienstleisterHersteller
Absatzmärkte
- Western Asia: Cyprus
- Northern Europe: Denmark, Finland, Iceland, Ireland, Norway, Sweden, United Kingdom
- Southern Europe: Andorra, Croatia, Greece, Italy, Malta, Portugal, Slovenia, Spain
- Western Europe: Austria, Belgium, France, Germany, Liechtenstein, Luxembourg, Monaco, Netherlands, Switzerland
- Northern America: Bermuda, Canada, Greenland, Saint Pierre and Miquelon, United States
Hauptprodukte/-dienstleistungen
- Pharmazeutische Wirkstoffe (API): IRBP R16 peptide (sequence ADGSSWEGVGVVPDV, amino acids 1177–1191), Human E7 Peptide (YMLDLQPET), NY-ESO-1 Peptide (SLLMWITQC), Recombinant Human Alpha-synuclein (mutated A53T) Protein, [β-Asp]9-Retatrutide, β-Amyloid(1-42) AD Animal Modeling Amyloid Beta Custom Modified & Fluorescent Labeled petide Synthesis, α-Factor Mating Pheromone, yeast, 3X FLAG PEPTIDE, Polypeptide Antibody Customization, Protein Purification, Expression and Preparation, 3X Flag Polypeptide, Acetyl Hexapeptide, Acetyl Octapeptide, Activation Peptide, Adrenomedullin (AM) (1-52), human, Agonist Peptide, Agonist Polypeptide, [Ala²⁸⁶]Calmodulin-Dependent Protein Kinase II (281-302) Polypeptide Synthesis, β-Alanine, β-Amyloid Peptide, Bioactive Peptide, Antigen Peptide Capsid protein H2-Ld (VPQYGYLTL), Antimicrobial peptides China Peptides, Apelin, (Arg8)-Vasotocin Polypeptide Synthesis, Custom Protein Purification, Antibody Preparation: (Arg⁸)-Vasotocin, Atrial Natriuretic Peptide (ANP) (1-28), human, porcine SLRRSSCFGGRMDRIGAQSGLGCNSFRY, Blue Copper Peptide, Bradykinin, C-Peptide (3-33), human EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ, C-Type Natriuretic Peptide, C-Type Natriuretic Peptide (CNP) (1-22), human GLSKGCFGLKLDRIGSMSGLGC, Calcitonin Gene Related Peptide (CGRP) (8-37), rat VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF, Catalog Peptide Customization, Protein Antibody: (Pyr¹)-Apelin-13 (human, bovine, mouse, rat), Catalog Peptide Synthesis, CEF10 CLGGLLTMV, Cell-Penetrating Peptide, Chemerin-9 (149-157) YFPGQFAFS, Conjugated Protein, COVID-19 Peptide Library, Custom Polypeptide Service, Custom Polypeptide Synthesis, Custom Polypeptide Synthesis, Protein: (Asp⁷⁶)-pTH (39-84) (human), Custom Polypeptide Synthesis, Protein Expression and Purification: (Nle²⁷)-GRF (1-29) amide (human), Custom Polypeptide/Protein Expression/Antibody Preparation: [Ala¹¹,D-Leu¹⁵]-Orexin B, human, Custom Synthesis, Protein Purification and Preparation of Antimicrobial Peptide Modified (Sar1,Tyr(Me)4)-Angiotensin, Cyclic Dipeptide, Cyclic Polypeptide, Cys-TAT(47-57), (D-2-Nal⁵,Cys⁶) Polypeptide Synthesis, Custom Synthesis Service, Protein Antibody, (D-Ala7)-Angiotensin I/II (1-7) Polypeptide Synthesis/Protein Expression/Antibody Preparation: (D-Ala⁷)-Angiotensin I/II (1-7), (D-Arg⁰,Hyp³,D-Phe⁷,Leu⁸)-Bradykinin, Polypeptide Synthesis/Protein Expression, [D-GLU]16-Mazdutide, [D-GLU]21-Mazdutide, [D-GLU]28-Mazdutide, D-His1-Mazdutide, [D-LEU]14-Mazdutide, [D-LEU]27-Mazdutide, [D-SER]33-Mazdutide, [D-TRP]25-Mazdutide, [D-VAL]23-Mazdutide, (Des-Arg⁹,Leu⁸)-Bradykinin, Bradykinin Synthesis, Modification, Fluorescent Labeled Antibody Preparation, (Des-Asp¹⁸⁷)-Melanocyte Protein, Isoleucyl-L-Threonyl Polypeptide Custom Synthesis, DYKDDDDK Peptide, Emeditide, Endogenous Agonist Peptide, Enkephalin, Enzyme Substrate Peptide, Eyelash Peptide, Feline-Related Antimicrobial Peptides, Fluorescent Labeled Antibody, Fluorescent Labeled Peptide, G280-9 YLEPGPVTA, Gastric Inhibitory Peptide (GIP), human, Glucagon-Like Peptide, GRGDSPC 91575-26-7 and 126646-79-5, growth hormone releasing peptide, HA Peptide YPYDVPDYA, HBV Peptide (FLLTRILTI), Hexa-His, hgp100(25-33), hgp100(25-33) KVPRNQDWL, Human Antimicrobial Peptide, Inhibitor-Related Peptide, Isotope-Labeled Peptide, Jagged-1 (188-204) CDDYYYGFGCNKFCRPR, KRAS G12D Peptide (VVVGADGVGK), Leucine Enkephalin, LL-37, scrambled GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, Luciferin-Labeled Somatostatin Peptide, MAGE-A4/MAGE-A8 Peptide (KVLEHVVRV), MAP-KLALKLALKALKAALKLA, MDYKDHDGDYKDHDIDYKDDDDK peptide, Morphiceptin, Myelin Oligodendrocyte Glycoprotein Fragment, Neuroactive Dipeptide, Neurokinin, Neurokinin A (4-10) Polypeptide Synthesis Company Services: Protein Gene Expression, Antibody Preparation, High-Efficiency Neurokinin A (4-10), Neuropeptide, Neuropeptide Substance P, Nonapeptide, OVA G4 peptide SIIGFEKL, OVA peptide (257-264), OVA Peptide (257-264) SIINFEKL, Cathelicidin Antimicrobial Peptides of Canine Origin, Chicken-derived chCATH-1 antimicrobial peptides, Oxytocin Impurity Peptide, Trifluoroacetic Acid Tripeptide, Palmitoyl Hexapeptide, PALMITOYL TETRAPEPTIDE, Palmitoyl Tripeptide, Horse-derived Cathelicidin antimicrobial peptide type 1, LL-37 of Human Cathelicidin Antimicrobial Peptides, Pep-7 SDLWEMMMVSLACQY, PNC-27 Antimicrobial peptides China Peptides (CAS NO.:1159861-00-3), PNC-28: A p53-Derived Peptide Targeting Cancer Cell Membranes, Polyarginine 12R, Polyarginine 12R RRRRRRRRRRRR, Polypeptide Antibody Customization, Polypeptide Antibody Modification, Polypeptide Antibody Preparation, Polypeptide Library Construction, Polypeptide Primer Synthesis, Polypeptide Purification, Polypeptide Screening, Polypeptide Synthesis and Modification, Polypeptide Synthesis, Custom Protein Modification, Antibody Purification and Preparation: (p-Amino-Phe⁶)-Angiotensin II, Polypeptide Synthesis, Modification, Protein Purification and Expression: (D-Phe¹²,Nle²¹·³⁸)-CRF (12-41), Porcine Bone Marrow Antimicrobial Peptide 23, PRAME Peptide (ALYVDSLFFL), Protein Antibody, Protein Antibody Purification, Protein Expression Dipeptide, Receptor Activation Peptide, Receptor Agonist Polypeptide, Recombinant Human Alpha-synuclein, Recombinant Human Protein Modification, Expression and Antibody Preparation, Recombinant Human FNDC5 Protein, Recombinant Human Renalase Protein, Recombinant Human Tau Protein, Recombinant Human Tau441 Protein, Recombinant Protein Expression and Preparation: Recombinant Human Alpha-synuclein (mutated A53T), Recombinant SARS-CoV-2/Spike Glycoprotein/RBD Protein, Recombinant Protein, RGD--GCGYGRGDSPG, RKKRRQRRR TAT(49-57), (Sar¹,Ile⁸)-Angiotensin II, Angiotensin Cosmetic Peptide Modification, Custom Protein Expression, SARS-CoV-2 Spike-derived Peptide (MFVFLVLLPLVSSQC), SARS-CoV-2 Spike-derived Peptide (YLQPRTFLL), SARS-CoV-2 Spike-derived Peptide (YNYKLPDDFTGCVIA), Sea Anemone Neurotoxin, Secretin, human HSDGTFTSELSRLREGARLQRLLQGLV, Ser-OH-Retatrutide, Ser39-OH-Tirzepatide, Stapled peptide, Substance Peptide, Tachykinin, TAT peptide GRKKRRQRRRPQ, (Tyr(Me)²¹)-Neuropeptide Y, Neuropeptide, Tyrosinase Restricted Peptide, (Tyr⁰,Trp²)-Melanocyte-Stimulating Hormone, Custom Polypeptide and Protein Expression, Thyroid Hormone-Related Peptide, Myelin-oligodendrocyte glycoprotein MOG protein express E. coli prokaryotic system, Urocortin (rat), Vasoactive intestinal peptide, WT-1 Peptide (RMFPNAPYL), Arginine, Aspartic acid, (Cit5)-TRAP-5, Cyclo-(L-Alanyl-L-Glutamine), Cyclo(Histidyl-Prolyl), Cyclo(L-Phenylalanyl-L-Phenylalanyl), Cyclo(Phenylalanyl-Prolyl) Dipeptide, Cysteinyl Glycine, Glycine, Human Hydroxyproline, L-Leucyl Glycine, L-Leucyl-L-Alanine, L-Phenylalanyl-L-Phenylalanine, Norleucine, Norleucyl, Octapeptide, Pyroglutamic Acid, [Ac-Cys4,DPhe7,Cys10], Gastrin, Isoleucine Oxytocin, Luteinizing Hormone-Releasing Hormone, Melanocyte-Stimulating Hormone Release-Inhibiting Factor, MelanotanⅡ, Big Endothelin and Analogs, ANGIOTENSIN Ⅱ, Angiotensinamide, Atosiban, Bombesin, (Des-Asp¹,Ile⁸)-Angiotensin, Angiotensin Polypeptide Synthesis, Modification, Activation Oxidase, Glucagon, Mitochondria-Targeted Antioxidant, (Sar1,Val5,Ala8)-Angiotensin II (Sar¹,Val⁵,Ala⁸)-Angiotensin II
- Biologische & Fermentationsrohstoffe: Custom Peptide Synthesis
- Biopharmazeutische Produkte: Custom antibody production
Unsere Produkte & Dienstleistungen
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
![[Ala²⁸⁶]Calmodulin-Dependent Protein Kinase II (281-302) Polypeptide Synthesis](/_next/image?url=https%3A%2F%2Fapi.pharmacountry.com%2Fuploads%2Fitems%2Falacalmodulin-dependent-protein-kinase-i-367765.jpg&w=640&q=75)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
![Custom Polypeptide/Protein Expression/Antibody Preparation: [Ala¹¹,D-Leu¹⁵]-Orexin B, human](/_next/image?url=https%3A%2F%2Fapi.pharmacountry.com%2Fuploads%2Fitems%2Fcustom-polypeptideprotein-expressionanti-367631.jpg&w=640&q=75)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Sell · Active Pharmaceutical Ingredients (APIs)
Bewertungen
(0)
(0)
(0)
(0)
(0)
Kommentare
Filter:
Sortieren nach:
Keine Kommentare verfügbar.
Bewertung & Kommentar hinterlassen